Lineage for d2ifgb2 (2ifg B:285-382)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 656838Family b.1.1.4: I set domains [49159] (36 proteins)
  6. 656961Protein High affinity nerve growth factor receptor TrkA, different domains [49190] (1 species)
  7. 656962Species Human (Homo sapiens) [TaxId:9606] [49191] (4 PDB entries)
  8. 656971Domain d2ifgb2: 2ifg B:285-382 [137339]
    Other proteins in same PDB: d2ifga3, d2ifgb3, d2ifge1, d2ifgf1
    automatically matched to d1he7a_
    complexed with bma, man, nag, ndg

Details for d2ifgb2

PDB Entry: 2ifg (more details), 3.4 Å

PDB Description: structure of the extracellular segment of human trka in complex with nerve growth factor
PDB Compounds: (B:) high affinity nerve growth factor receptor

SCOP Domain Sequences for d2ifgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ifgb2 b.1.1.4 (B:285-382) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]}
pasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetvrhg
clrlnqpthvnngnytllaanpfgqasasimaafmdnp

SCOP Domain Coordinates for d2ifgb2:

Click to download the PDB-style file with coordinates for d2ifgb2.
(The format of our PDB-style files is described here.)

Timeline for d2ifgb2: