Lineage for d2ifgb1 (2ifg B:192-283)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295367Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1295508Protein High affinity nerve growth factor receptor TrkA, different domains [49190] (1 species)
  7. 1295509Species Human (Homo sapiens) [TaxId:9606] [49191] (4 PDB entries)
  8. 1295517Domain d2ifgb1: 2ifg B:192-283 [137338]
    Other proteins in same PDB: d2ifga3, d2ifgb3, d2ifge1, d2ifgf1
    automatically matched to 2IFG A:192-283

Details for d2ifgb1

PDB Entry: 2ifg (more details), 3.4 Å

PDB Description: structure of the extracellular segment of human trka in complex with nerve growth factor
PDB Compounds: (B:) high affinity nerve growth factor receptor

SCOPe Domain Sequences for d2ifgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ifgb1 b.1.1.4 (B:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]}
gvptlkvqvpnasvdvgddvllrcqvegrgleqagwilteleqsatvmksgglpslgltl
anvtsdlnrknvtcwaendvgraevsvqvnvs

SCOPe Domain Coordinates for d2ifgb1:

Click to download the PDB-style file with coordinates for d2ifgb1.
(The format of our PDB-style files is described here.)

Timeline for d2ifgb1: