| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein High affinity nerve growth factor receptor TrkA, different domains [49190] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49191] (4 PDB entries) |
| Domain d2ifgb1: 2ifg B:192-283 [137338] Other proteins in same PDB: d2ifga3, d2ifgb3, d2ifge1, d2ifgf1 automatically matched to 2IFG A:192-283 |
PDB Entry: 2ifg (more details), 3.4 Å
SCOPe Domain Sequences for d2ifgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ifgb1 b.1.1.4 (B:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]}
gvptlkvqvpnasvdvgddvllrcqvegrgleqagwilteleqsatvmksgglpslgltl
anvtsdlnrknvtcwaendvgraevsvqvnvs
Timeline for d2ifgb1: