Lineage for d2ifga3 (2ifg A:36-191)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823992Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 824043Superfamily c.10.2: L domain-like [52058] (8 families) (S)
    less regular structure consisting of variable repeats
  5. 824152Family c.10.2.7: Ngr ectodomain-like [75142] (6 proteins)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 824162Protein High affinity nerve growth factor receptor, N-terminal domain [141992] (1 species)
  7. 824163Species Human (Homo sapiens) [TaxId:9606] [141993] (1 PDB entry)
    Uniprot P04629 36-191
  8. 824164Domain d2ifga3: 2ifg A:36-191 [137337]
    Other proteins in same PDB: d2ifga1, d2ifga2, d2ifgb1, d2ifgb2, d2ifge1, d2ifgf1
    complexed with bma, man, nag, ndg

Details for d2ifga3

PDB Entry: 2ifg (more details), 3.4 Å

PDB Description: structure of the extracellular segment of human trka in complex with nerve growth factor
PDB Compounds: (A:) high affinity nerve growth factor receptor

SCOP Domain Sequences for d2ifga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
cpdaccphgssglrctrdgaldslhhlpgaenltelyienqqhlqhlelrdlrglgelrn
ltivksglrfvapdafhftprlsrlnlsfnaleslswktvqglslqelvlsgnplhcsca
lrwlqrweeeglggvpeqklqchgqgplahmpnasc

SCOP Domain Coordinates for d2ifga3:

Click to download the PDB-style file with coordinates for d2ifga3.
(The format of our PDB-style files is described here.)

Timeline for d2ifga3: