![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins) applies to all domains of a family if the common domain is composed of a different number of small repeating units this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain |
![]() | Protein High affinity nerve growth factor receptor, N-terminal domain [141992] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141993] (1 PDB entry) Uniprot P04629 36-191 |
![]() | Domain d2ifga3: 2ifg A:36-191 [137337] Other proteins in same PDB: d2ifga1, d2ifga2, d2ifgb1, d2ifgb2, d2ifge1, d2ifgf1 |
PDB Entry: 2ifg (more details), 3.4 Å
SCOPe Domain Sequences for d2ifga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} cpdaccphgssglrctrdgaldslhhlpgaenltelyienqqhlqhlelrdlrglgelrn ltivksglrfvapdafhftprlsrlnlsfnaleslswktvqglslqelvlsgnplhcsca lrwlqrweeeglggvpeqklqchgqgplahmpnasc
Timeline for d2ifga3: