Lineage for d2ifaf_ (2ifa F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569893Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2569894Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2569895Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 2569923Protein Hypothetical protein Smu.260 [143610] (1 species)
  7. 2569924Species Streptococcus mutans [TaxId:1309] [143611] (2 PDB entries)
    Uniprot Q8DW21 2-200
  8. 2569936Domain d2ifaf_: 2ifa F: [137334]
    Other proteins in same PDB: d2ifaa2, d2ifab3, d2ifac3, d2ifad3, d2ifae3
    automated match to d2ifaa1
    complexed with fmn

Details for d2ifaf_

PDB Entry: 2ifa (more details), 2.3 Å

PDB Description: crystal structure of the putative nitroreductase (smu.260) in complex with fmn from streptococcus mutans, northeast structural genomics target smr5.
PDB Compounds: (F:) Hypothetical protein SMU.260

SCOPe Domain Sequences for d2ifaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ifaf_ d.90.1.1 (F:) Hypothetical protein Smu.260 {Streptococcus mutans [TaxId: 1309]}
snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
pagekefmadqerfkvfgd

SCOPe Domain Coordinates for d2ifaf_:

Click to download the PDB-style file with coordinates for d2ifaf_.
(The format of our PDB-style files is described here.)

Timeline for d2ifaf_: