Lineage for d2ifaf1 (2ifa F:2-200)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728985Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 728986Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (2 families) (S)
  5. 728987Family d.90.1.1: NADH oxidase/flavin reductase [55470] (8 proteins)
  6. 729013Protein Hypothetical protein Smu.260 [143610] (1 species)
  7. 729014Species Streptococcus mutans [TaxId:1309] [143611] (1 PDB entry)
  8. 729020Domain d2ifaf1: 2ifa F:2-200 [137334]
    automatically matched to 2IFA A:2-200
    complexed with fmn

Details for d2ifaf1

PDB Entry: 2ifa (more details), 2.3 Å

PDB Description: crystal structure of the putative nitroreductase (smu.260) in complex with fmn from streptococcus mutans, northeast structural genomics target smr5.
PDB Compounds: (F:) Hypothetical protein SMU.260

SCOP Domain Sequences for d2ifaf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ifaf1 d.90.1.1 (F:2-200) Hypothetical protein Smu.260 {Streptococcus mutans [TaxId: 1309]}
snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
pagekefmadqerfkvfgd

SCOP Domain Coordinates for d2ifaf1:

Click to download the PDB-style file with coordinates for d2ifaf1.
(The format of our PDB-style files is described here.)

Timeline for d2ifaf1: