SCOP 1.73: Domain d2ifad1: 2ifa D:2-200

Lineage for d2ifad1 (2ifa D:2-200)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (2 families)

5. Family d.90.1.1: NADH oxidase/flavin reductase [55470] (8 proteins)

6. Protein Hypothetical protein Smu.260 [143610] (1 species)

7. Species Streptococcus mutans [TaxId:1309] [143611] (1 PDB entry)

8. Domain d2ifad1: 2ifa D:2-200 [137332]
   automatically matched to 2IFA A:2-200
   complexed with fmn

Details for d2ifad1

PDB Entry: 2ifa, 2.3 Å

PDB Description: crystal structure of the putative nitroreductase (smu.260) in complex with fmn from streptococcus mutans, northeast structural genomics target smr5.

PDB Compounds: (D:) Hypothetical protein SMU.260

SCOP Domain Sequences for d2ifad1:

Sequence; same for both SEQRES and ATOM records:

>d2ifad1 d.90.1.1 (D:2-200) Hypothetical protein Smu.260 {Streptococcus mutans [TaxId: 1309]}
snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
pagekefmadqerfkvfgd

Timeline for d2ifad1:

• d2ifad1 is new in SCOP 1.73
  
• d2ifad1 appears in SCOP 1.75
  
• d2ifad1 appears in the current release, SCOPe 2.08, called d2ifad2