Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) |
Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins) |
Protein Hypothetical protein Smu.260 [143610] (1 species) |
Species Streptococcus mutans [TaxId:1309] [143611] (2 PDB entries) Uniprot Q8DW21 2-200 |
Domain d2ifac2: 2ifa C:2-200 [137331] Other proteins in same PDB: d2ifaa2, d2ifab3, d2ifac3, d2ifad3, d2ifae3 automated match to d2ifaa1 complexed with fmn |
PDB Entry: 2ifa (more details), 2.3 Å
SCOPe Domain Sequences for d2ifac2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ifac2 d.90.1.1 (C:2-200) Hypothetical protein Smu.260 {Streptococcus mutans [TaxId: 1309]} snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea pagekefmadqerfkvfgd
Timeline for d2ifac2: