Lineage for d2ifac2 (2ifa C:2-200)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. Protein Hypothetical protein Smu.260 [143610] (1 species)
  7. Species Streptococcus mutans [TaxId:1309] [143611] (2 PDB entries)
    Uniprot Q8DW21 2-200
  8. Domain d2ifac2: 2ifa C:2-200 [137331]
    Other proteins in same PDB: d2ifaa2, d2ifab3, d2ifac3, d2ifad3, d2ifae3
    automated match to d2ifaa1
    complexed with fmn

Details for d2ifac2

PDB Entry: 2ifa (more details), 2.3 Å

PDB Description: crystal structure of the putative nitroreductase (smu.260) in complex with fmn from streptococcus mutans, northeast structural genomics target smr5.
PDB Compounds: (C:) Hypothetical protein SMU.260

SCOPe Domain Sequences for d2ifac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ifac2 d.90.1.1 (C:2-200) Hypothetical protein Smu.260 {Streptococcus mutans [TaxId: 1309]}
snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
pagekefmadqerfkvfgd

SCOPe Domain Coordinates for d2ifac2 are not available.

Timeline for d2ifac2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ifac3
View in 3D
Domains from other chains:
(mouse over for more information)
d2ifaa1, d2ifaa2, d2ifab2, d2ifab3, d2ifad2, d2ifad3, d2ifae2, d2ifae3, d2ifaf_