SCOPe 2.05: Domain d2ifab_: 2ifa B:

Lineage for d2ifab_ (2ifa B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)

6. Protein Hypothetical protein Smu.260 [143610] (1 species)

7. Species Streptococcus mutans [TaxId:1309] [143611] (1 PDB entry)
   Uniprot Q8DW21 2-200

8. Domain d2ifab_: 2ifa B: [137330]
   automated match to d2ifaa1
   complexed with fmn

Details for d2ifab_

PDB Entry: 2ifa, 2.3 Å

PDB Description: crystal structure of the putative nitroreductase (smu.260) in complex with fmn from streptococcus mutans, northeast structural genomics target smr5.

PDB Compounds: (B:) Hypothetical protein SMU.260

SCOPe Domain Sequences for d2ifab_:

Sequence; same for both SEQRES and ATOM records:

>d2ifab_ d.90.1.1 (B:) Hypothetical protein Smu.260 {Streptococcus mutans [TaxId: 1309]}
snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
pagekefmadqerfkvfgdle

Timeline for d2ifab_:

• d2ifab_ first appeared in SCOP 1.73, called d2ifab1
  
• d2ifab_ appears in SCOPe 2.04
  
• d2ifab_ is called d2ifab2 in SCOPe 2.06
  
• d2ifab_ appears in the current release, SCOPe 2.08, called d2ifab2