SCOPe 2.01: Domain d2ifaa1: 2ifa A:2-200

Lineage for d2ifaa1 (2ifa A:2-200)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)

6. Protein Hypothetical protein Smu.260 [143610] (1 species)

7. Species Streptococcus mutans [TaxId:1309] [143611] (1 PDB entry)
   Uniprot Q8DW21 2-200

8. Domain d2ifaa1: 2ifa A:2-200 [137329]
   complexed with fmn

Details for d2ifaa1

PDB Entry: 2ifa, 2.3 Å

PDB Description: crystal structure of the putative nitroreductase (smu.260) in complex with fmn from streptococcus mutans, northeast structural genomics target smr5.

PDB Compounds: (A:) Hypothetical protein SMU.260

SCOPe Domain Sequences for d2ifaa1:

Sequence; same for both SEQRES and ATOM records:

>d2ifaa1 d.90.1.1 (A:2-200) Hypothetical protein Smu.260 {Streptococcus mutans [TaxId: 1309]}
snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
pagekefmadqerfkvfgd

Timeline for d2ifaa1:

• d2ifaa1 first appeared in SCOP 1.73
  
• d2ifaa1 appears in SCOP 1.75
  
• d2ifaa1 appears in SCOPe 2.02
  
• d2ifaa1 appears in the current release, SCOPe 2.08