![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
![]() | Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (2 families) ![]() |
![]() | Family d.90.1.1: NADH oxidase/flavin reductase [55470] (8 proteins) |
![]() | Protein Hypothetical protein Smu.260 [143610] (1 species) |
![]() | Species Streptococcus mutans [TaxId:1309] [143611] (1 PDB entry) |
![]() | Domain d2ifaa1: 2ifa A:2-200 [137329] complexed with fmn |
PDB Entry: 2ifa (more details), 2.3 Å
SCOP Domain Sequences for d2ifaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ifaa1 d.90.1.1 (A:2-200) Hypothetical protein Smu.260 {Streptococcus mutans [TaxId: 1309]} snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea pagekefmadqerfkvfgd
Timeline for d2ifaa1: