Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily) alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325 |
Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) |
Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins) |
Protein The origin DNA-binding domain of SV40 T-antigen [55466] (1 species) |
Species Simian virus 40, Sv40 [TaxId:10633] [55467] (11 PDB entries) |
Domain d2if9b_: 2if9 B: [137328] automated match to d1tbd__ |
PDB Entry: 2if9 (more details), 2.59 Å
SCOPe Domain Sequences for d2if9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2if9b_ d.89.1.1 (B:) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]} skvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhns ynhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslp gglkehdfnpe
Timeline for d2if9b_: