Lineage for d2if9a1 (2if9 A:131-256)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728917Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 728918Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (5 families) (S)
  5. 728919Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (1 protein)
  6. 728920Protein The origin DNA-binding domain of SV40 T-antigen [55466] (1 species)
  7. 728921Species Simian virus 40, Sv40 [TaxId:10633] [55467] (9 PDB entries)
  8. 728931Domain d2if9a1: 2if9 A:131-256 [137327]
    automatically matched to d1tbd__

Details for d2if9a1

PDB Entry: 2if9 (more details), 2.59 Å

PDB Description: crystal structure of sv40 t-antigen origin binding domain disulfide- linked dimer
PDB Compounds: (A:) large t antigen

SCOP Domain Sequences for d2if9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2if9a1 d.89.1.1 (A:131-256) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
kvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsy
nhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpg
glkehd

SCOP Domain Coordinates for d2if9a1:

Click to download the PDB-style file with coordinates for d2if9a1.
(The format of our PDB-style files is described here.)

Timeline for d2if9a1: