Lineage for d2iesb1 (2ies B:2-133)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891698Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1891699Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1892206Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins)
    duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site
  6. 1892207Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)
  7. 1892208Species Aquifex aeolicus [TaxId:63363] [89829] (13 PDB entries)
    Uniprot O67648 3-270
  8. 1892247Domain d2iesb1: 2ies B:2-133 [137325]
    automated match to d2iesa1
    complexed with cl, plm, pop, zn

Details for d2iesb1

PDB Entry: 2ies (more details), 3.1 Å

PDB Description: crystal structure of aquifex aeolicus lpxc complexed with pyrophosphate
PDB Compounds: (B:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d2iesb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iesb1 d.14.1.7 (B:2-133) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei
dyfvve

SCOPe Domain Coordinates for d2iesb1:

Click to download the PDB-style file with coordinates for d2iesb1.
(The format of our PDB-style files is described here.)

Timeline for d2iesb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iesb2