Lineage for d2ierb2 (2ier B:134-280)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 853454Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (1 protein)
    duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site
  6. 853455Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)
  7. 853456Species Aquifex aeolicus [TaxId:63363] [89829] (11 PDB entries)
    Uniprot O67648 3-270
  8. 853482Domain d2ierb2: 2ier B:134-280 [137322]
    automatically matched to d1xxea2
    complexed with gol, plm, udp, zn; mutant

Details for d2ierb2

PDB Entry: 2ier (more details), 2.7 Å

PDB Description: Crystal Structure of Aquifex aeolicus LpxC Complexed with Uridine 5'-Diphosphate
PDB Compounds: (B:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOP Domain Sequences for d2ierb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ierb2 d.14.1.7 (B:134-280) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfafdweie
hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy
sfrgghslnvklvkelakkqk

SCOP Domain Coordinates for d2ierb2:

Click to download the PDB-style file with coordinates for d2ierb2.
(The format of our PDB-style files is described here.)

Timeline for d2ierb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ierb1