Lineage for d2ierb1 (2ier B:2-133)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins)
    duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site
  6. Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)
  7. Species Aquifex aeolicus [TaxId:63363] [89829] (18 PDB entries)
    Uniprot O67648 3-270
  8. Domain d2ierb1: 2ier B:2-133 [137321]
    automated match to d2go3a1
    complexed with gol, plm, udp, zn

Details for d2ierb1

PDB Entry: 2ier (more details), 2.7 Å

PDB Description: Crystal Structure of Aquifex aeolicus LpxC Complexed with Uridine 5'-Diphosphate
PDB Compounds: (B:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d2ierb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ierb1 d.14.1.7 (B:2-133) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei
dyfvve

SCOPe Domain Coordinates for d2ierb1 are not available.

Timeline for d2ierb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ierb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2iera1, d2iera2