SCOP 1.75: Domain d2iera2: 2ier A:134-280

Lineage for d2iera2 (2ier A:134-280)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (1 protein)
   duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site

6. Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [89829] (11 PDB entries)
   Uniprot O67648 3-270

8. Domain d2iera2: 2ier A:134-280 [137320]
   automatically matched to d1xxea2
   complexed with gol, plm, udp, zn; mutant

Details for d2iera2

PDB Entry: 2ier, 2.7 Å

PDB Description: crystal structure of aquifex aeolicus lpxc complexed with uridine 5'- diphosphate

PDB Compounds: (A:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOP Domain Sequences for d2iera2:

Sequence; same for both SEQRES and ATOM records:

>d2iera2 d.14.1.7 (A:134-280) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfafdweie
hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy
sfrgghslnvklvkelakkqk

Timeline for d2iera2:

• d2iera2 first appeared in SCOP 1.73
  
• d2iera2 appears in SCOPe 2.01
  
• d2iera2 appears in the current release, SCOPe 2.08