Lineage for d2iera2 (2ier A:134-280)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 716940Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (1 protein)
    duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site
  6. 716941Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)
  7. 716942Species Aquifex aeolicus [TaxId:63363] [89829] (10 PDB entries)
  8. 716970Domain d2iera2: 2ier A:134-280 [137320]
    automatically matched to d1xxea2
    complexed with gol, plm, udp, zn; mutant

Details for d2iera2

PDB Entry: 2ier (more details), 2.7 Å

PDB Description: Crystal Structure of Aquifex aeolicus LpxC Complexed with Uridine 5'-Diphosphate
PDB Compounds: (A:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOP Domain Sequences for d2iera2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iera2 d.14.1.7 (A:134-280) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfafdweie
hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy
sfrgghslnvklvkelakkqk

SCOP Domain Coordinates for d2iera2:

Click to download the PDB-style file with coordinates for d2iera2.
(The format of our PDB-style files is described here.)

Timeline for d2iera2:

Domains from same chain:
(mouse over for more information)
d2iera1
Domains from other chains:
(mouse over for more information)
d2ierb1, d2ierb2