SCOPe 2.07: Domain d2iejb_: 2iej B:

Lineage for d2iejb_ (2iej B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69090] (13 PDB entries)
   Uniprot P49356

8. Domain d2iejb_: 2iej B: [137314]
   Other proteins in same PDB: d2ieja_
   automated match to d1tn6b_
   complexed with act, fii, s48, suc, zn

Details for d2iejb_

PDB Entry: 2iej, 1.8 Å

PDB Description: human protein farnesyltransferase complexed with inhibitor compound stn-48 and fpp analog at 1.8a resolution

PDB Compounds: (B:) Protein farnesyltransferase subunit beta

SCOPe Domain Sequences for d2iejb_:

Sequence; same for both SEQRES and ATOM records:

>d2iejb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq
rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq
speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh
vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc
glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra
lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaq
hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe

Timeline for d2iejb_:

• d2iejb_ first appeared in SCOP 1.73, called d2iejb1
  
• d2iejb_ appears in SCOPe 2.06
  
• d2iejb_ appears in the current release, SCOPe 2.08