![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.9: Motor proteins [52641] (5 proteins) |
![]() | Protein automated matches [190129] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187145] (33 PDB entries) |
![]() | Domain d2iehb_: 2ieh B: [137310] automated match to d1q0bb_ complexed with adp, cl, k, mg, moy, pg4 |
PDB Entry: 2ieh (more details), 2.7 Å
SCOPe Domain Sequences for d2iehb_:
Sequence, based on SEQRES records: (download)
>d2iehb_ c.37.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgas tkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagi iprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvi ikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeel vkigklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphvpyresk ltrilqdslggrtrtsiiatispaslnleetlstleyahraknilnkpevn
>d2iehb_ c.37.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgas tkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagi iprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvi ikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeel vkigklnlvdlagseninqslltlgrvitalvertphvpyreskltrilqdslggrtrts iiatispaslnleetlstleyahraknilnkpevn
Timeline for d2iehb_: