Lineage for d2iefb1 (2ief B:1-54)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636570Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 636571Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families) (S)
  5. 636641Family a.6.1.7: Excisionase-like [46891] (2 proteins)
    kinked C-terminal helix
  6. 636642Protein Excisionase Xis [89004] (1 species)
  7. 636643Species Bacteriophage lambda [TaxId:10710] [89005] (5 PDB entries)
  8. 636649Domain d2iefb1: 2ief B:1-54 [137305]
    automatically matched to d1lx8a_
    mutant

Details for d2iefb1

PDB Entry: 2ief (more details), 2.6 Å

PDB Description: structure of the cooperative excisionase (xis)-dna complex reveals a micronucleoprotein filament
PDB Compounds: (B:) Excisionase

SCOP Domain Sequences for d2iefb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iefb1 a.6.1.7 (B:1-54) Excisionase Xis {Bacteriophage lambda [TaxId: 10710]}
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnr

SCOP Domain Coordinates for d2iefb1:

Click to download the PDB-style file with coordinates for d2iefb1.
(The format of our PDB-style files is described here.)

Timeline for d2iefb1: