![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
![]() | Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) ![]() |
![]() | Family a.6.1.7: Excisionase-like [46891] (2 proteins) kinked C-terminal helix |
![]() | Protein Excisionase Xis [89004] (1 species) |
![]() | Species Bacteriophage lambda [TaxId:10710] [89005] (5 PDB entries) Uniprot P03699 1-55 |
![]() | Domain d2iefa_: 2ief A: [137304] automated match to d1lx8a_ protein/DNA complex |
PDB Entry: 2ief (more details), 2.6 Å
SCOPe Domain Sequences for d2iefa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iefa_ a.6.1.7 (A:) Excisionase Xis {Bacteriophage lambda [TaxId: 10710]} myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp
Timeline for d2iefa_: