Lineage for d2iecb_ (2iec B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616474Fold d.316: MK0786-like [143559] (1 superfamily)
    alpha(2)-beta(4); 2 layers: a/b; antiparallel beta-sheet, order 1234 (meander)
  4. 2616475Superfamily d.316.1: MK0786-like [143560] (2 families) (S)
    probable biological unit is a teramer; all subunit interfaces are provided by helices
  5. 2616476Family d.316.1.1: MK0786-like [143561] (2 proteins)
    single domain; the N-terminal half is covered by Pfam PF04036 (DUF372) and the C-terminal half by Pfam PF04038 (DUF381)
  6. 2616477Protein Hypothetical protein MK0786 [143564] (1 species)
  7. 2616478Species Methanopyrus kandleri [TaxId:2320] [143565] (1 PDB entry)
    Uniprot Q8TX89 7-119
  8. 2616480Domain d2iecb_: 2iec B: [137301]
    automated match to d2ieca1
    complexed with mg

Details for d2iecb_

PDB Entry: 2iec (more details), 2.33 Å

PDB Description: crystal structure of uncharacterized conserved archael protein from methanopyrus kandleri
PDB Compounds: (B:) Uncharacterized protein conserved in archaea

SCOPe Domain Sequences for d2iecb_:

Sequence, based on SEQRES records: (download)

>d2iecb_ d.316.1.1 (B:) Hypothetical protein MK0786 {Methanopyrus kandleri [TaxId: 2320]}
yfkrlsdreraifeagitlgaiyhqfcgtpvspgtaeevakcieraallqpcvidarvev
dvssedtdnyggytevsgrnlrvtivtrcgeweavgklefieelnyplmwveeirr

Sequence, based on observed residues (ATOM records): (download)

>d2iecb_ d.316.1.1 (B:) Hypothetical protein MK0786 {Methanopyrus kandleri [TaxId: 2320]}
yfkrlsdreraifeagitlgaiyhqfcgtpvspgtaeevakcieraallqpcvidarvev
dvsstdnyggytevsgrnlrvtivtrcgeweavgklefieelnyplmwveeirr

SCOPe Domain Coordinates for d2iecb_:

Click to download the PDB-style file with coordinates for d2iecb_.
(The format of our PDB-style files is described here.)

Timeline for d2iecb_: