SCOPe 2.07: Domain d2iecb_: 2iec B:

Lineage for d2iecb_ (2iec B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.316: MK0786-like [143559] (1 superfamily)
   alpha(2)-beta(4); 2 layers: a/b; antiparallel beta-sheet, order 1234 (meander)

4. Superfamily d.316.1: MK0786-like [143560] (2 families)
   probable biological unit is a teramer; all subunit interfaces are provided by helices

5. Family d.316.1.1: MK0786-like [143561] (2 proteins)
   single domain; the N-terminal half is covered by Pfam PF04036 (DUF372) and the C-terminal half by Pfam PF04038 (DUF381)

6. Protein Hypothetical protein MK0786 [143564] (1 species)

7. Species Methanopyrus kandleri [TaxId:2320] [143565] (1 PDB entry)
   Uniprot Q8TX89 7-119

8. Domain d2iecb_: 2iec B: [137301]
   automated match to d2ieca1
   complexed with mg

Details for d2iecb_

PDB Entry: 2iec, 2.33 Å

PDB Description: crystal structure of uncharacterized conserved archael protein from methanopyrus kandleri

PDB Compounds: (B:) Uncharacterized protein conserved in archaea

SCOPe Domain Sequences for d2iecb_:

Sequence, based on SEQRES records:

>d2iecb_ d.316.1.1 (B:) Hypothetical protein MK0786 {Methanopyrus kandleri [TaxId: 2320]}
yfkrlsdreraifeagitlgaiyhqfcgtpvspgtaeevakcieraallqpcvidarvev
dvssedtdnyggytevsgrnlrvtivtrcgeweavgklefieelnyplmwveeirr

Sequence, based on observed residues (ATOM records):

>d2iecb_ d.316.1.1 (B:) Hypothetical protein MK0786 {Methanopyrus kandleri [TaxId: 2320]}
yfkrlsdreraifeagitlgaiyhqfcgtpvspgtaeevakcieraallqpcvidarvev
dvsstdnyggytevsgrnlrvtivtrcgeweavgklefieelnyplmwveeirr

Timeline for d2iecb_:

• d2iecb_ first appeared in SCOP 1.73, called d2iecb1
  
• d2iecb_ appears in SCOPe 2.06
  
• d2iecb_ appears in the current release, SCOPe 2.08