![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.316: MK0786-like [143559] (1 superfamily) alpha(2)-beta(4); 2 layers: a/b; antiparallel beta-sheet, order 1234 (meander) |
![]() | Superfamily d.316.1: MK0786-like [143560] (2 families) ![]() probable biological unit is a teramer; all subunit interfaces are provided by helices |
![]() | Family d.316.1.1: MK0786-like [143561] (2 proteins) single domain; the N-terminal half is covered by Pfam PF04036 (DUF372) and the C-terminal half by Pfam PF04038 (DUF381) |
![]() | Protein Hypothetical protein MK0786 [143564] (1 species) |
![]() | Species Methanopyrus kandleri [TaxId:2320] [143565] (1 PDB entry) Uniprot Q8TX89 7-119 |
![]() | Domain d2ieca1: 2iec A:11-123 [137300] complexed with mg |
PDB Entry: 2iec (more details), 2.33 Å
SCOPe Domain Sequences for d2ieca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ieca1 d.316.1.1 (A:11-123) Hypothetical protein MK0786 {Methanopyrus kandleri [TaxId: 2320]} lsdreraifeagitlgaiyhqfcgtpvspgtaeevakcieraallqpcvidarvevdvss edtdnyggytevsgrnlrvtivtrcgeweavgklefieelnyplmwveeirrv
Timeline for d2ieca1: