Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) |
Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins) |
Protein Pyruvate dehydrogenase E1 component, C-domain [75239] (1 species) E1A and E1B fused together in a single-chain protein |
Species Escherichia coli [TaxId:562] [75240] (8 PDB entries) |
Domain d2ieaa3: 2iea A:701-886 [137296] Other proteins in same PDB: d2ieaa1, d2ieaa2, d2ieab1, d2ieab2 automatically matched to d1l8aa3 complexed with mg, tdp |
PDB Entry: 2iea (more details), 1.85 Å
SCOP Domain Sequences for d2ieaa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ieaa3 c.48.1.1 (A:701-886) Pyruvate dehydrogenase E1 component, C-domain {Escherichia coli [TaxId: 562]} mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk vnprla
Timeline for d2ieaa3: