SCOPe 2.04: Domain d2idod_: 2ido D:

Lineage for d2idod_ (2ido D:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family)
   automatically mapped to Pfam PF06440

5. Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins)
   Pfam PF06440
   independent solution structure determinations of different members resulted in similar secondary structures but different folds

6. Protein Homolog of theta (HOT) [116866] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [116867] (2 PDB entries)
   Uniprot Q71T70

8. Domain d2idod_: 2ido D: [137287]
   Other proteins in same PDB: d2idoa_, d2idoc_
   automated match to d1se7a_
   complexed with edo, mn, tmp

Details for d2idod_

PDB Entry: 2ido, 2.1 Å

PDB Description: Structure of the E. coli Pol III epsilon-Hot proofreading complex

PDB Compounds: (D:) Hot protein

SCOPe Domain Sequences for d2idod_:

Sequence; same for both SEQRES and ATOM records:

>d2idod_ a.237.1.1 (D:) Homolog of theta (HOT) {Bacteriophage P1 [TaxId: 10678]}
mydwniaaksqeerdkvnvdlaasgvaykerlnipviaeqvareqpenlrtyfmerlrhy
rqlslqlpkgsdpayq

Timeline for d2idod_:

• d2idod_ first appeared in SCOP 1.73, called d2idod1
  
• d2idod_ appears in SCOPe 2.03
  
• d2idod_ appears in SCOPe 2.05
  
• d2idod_ appears in the current release, SCOPe 2.08