Lineage for d2idoc_ (2ido C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886872Protein automated matches [190162] (6 species)
    not a true protein
  7. 2886889Species Escherichia coli [TaxId:562] [187263] (14 PDB entries)
  8. 2886893Domain d2idoc_: 2ido C: [137286]
    Other proteins in same PDB: d2idob_, d2idod_
    automated match to d1j53a_
    complexed with edo, mn, tmp

Details for d2idoc_

PDB Entry: 2ido (more details), 2.1 Å

PDB Description: Structure of the E. coli Pol III epsilon-Hot proofreading complex
PDB Compounds: (C:) DNA polymerase III epsilon subunit

SCOPe Domain Sequences for d2idoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2idoc_ c.55.3.5 (C:) automated matches {Escherichia coli [TaxId: 562]}
trqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgv
hgiadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfc
kvtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg

SCOPe Domain Coordinates for d2idoc_:

Click to download the PDB-style file with coordinates for d2idoc_.
(The format of our PDB-style files is described here.)

Timeline for d2idoc_: