| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily) 3 helices; irregular array |
Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family) ![]() automatically mapped to Pfam PF06440 |
| Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins) Pfam PF06440 independent solution structure determinations of different members resulted in similar secondary structures but different folds |
| Protein Homolog of theta (HOT) [116866] (1 species) |
| Species Bacteriophage P1 [TaxId:10678] [116867] (2 PDB entries) Uniprot Q71T70 |
| Domain d2idob_: 2ido B: [137285] Other proteins in same PDB: d2idoa_, d2idoc_ automated match to d1se7a_ complexed with edo, mn, tmp |
PDB Entry: 2ido (more details), 2.1 Å
SCOPe Domain Sequences for d2idob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2idob_ a.237.1.1 (B:) Homolog of theta (HOT) {Bacteriophage P1 [TaxId: 10678]}
ydwniaaksqeerdkvnvdlaasgvaykerlnipviaeqvareqpenlrtyfmerlrhyr
qlslqlpkgsdpayq
Timeline for d2idob_: