Lineage for d2idob_ (2ido B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1509153Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
    3 helices; irregular array
  4. 1509154Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family) (S)
    automatically mapped to Pfam PF06440
  5. 1509155Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins)
    Pfam PF06440
    independent solution structure determinations of different members resulted in similar secondary structures but different folds
  6. 1509156Protein Homolog of theta (HOT) [116866] (1 species)
  7. 1509157Species Bacteriophage P1 [TaxId:10678] [116867] (2 PDB entries)
    Uniprot Q71T70
  8. 1509158Domain d2idob_: 2ido B: [137285]
    Other proteins in same PDB: d2idoa_, d2idoc_
    automated match to d1se7a_
    complexed with edo, mn, tmp

Details for d2idob_

PDB Entry: 2ido (more details), 2.1 Å

PDB Description: Structure of the E. coli Pol III epsilon-Hot proofreading complex
PDB Compounds: (B:) Hot protein

SCOPe Domain Sequences for d2idob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2idob_ a.237.1.1 (B:) Homolog of theta (HOT) {Bacteriophage P1 [TaxId: 10678]}
ydwniaaksqeerdkvnvdlaasgvaykerlnipviaeqvareqpenlrtyfmerlrhyr
qlslqlpkgsdpayq

SCOPe Domain Coordinates for d2idob_:

Click to download the PDB-style file with coordinates for d2idob_.
(The format of our PDB-style files is described here.)

Timeline for d2idob_: