SCOPe 2.08: Domain d2idob_: 2ido B:

Lineage for d2idob_ (2ido B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family)
   automatically mapped to Pfam PF06440

5. Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins)
   Pfam PF06440
   independent solution structure determinations of different members resulted in similar secondary structures but different folds

6. Protein Homolog of theta (HOT) [116866] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [116867] (2 PDB entries)
   Uniprot Q71T70

8. Domain d2idob_: 2ido B: [137285]
   Other proteins in same PDB: d2idoa_, d2idoc_
   automated match to d1se7a_
   complexed with edo, mn, tmp

Details for d2idob_

PDB Entry: 2ido, 2.1 Å

PDB Description: Structure of the E. coli Pol III epsilon-Hot proofreading complex

PDB Compounds: (B:) Hot protein

SCOPe Domain Sequences for d2idob_:

Sequence; same for both SEQRES and ATOM records:

>d2idob_ a.237.1.1 (B:) Homolog of theta (HOT) {Bacteriophage P1 [TaxId: 10678]}
ydwniaaksqeerdkvnvdlaasgvaykerlnipviaeqvareqpenlrtyfmerlrhyr
qlslqlpkgsdpayq

Timeline for d2idob_:

• d2idob_ first appeared in SCOP 1.73, called d2idob1
  
• d2idob_ appears in SCOPe 2.07