Lineage for d2idoa_ (2ido A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1607175Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1607536Protein automated matches [190162] (4 species)
    not a true protein
  7. 1607547Species Escherichia coli [TaxId:562] [187263] (13 PDB entries)
  8. 1607550Domain d2idoa_: 2ido A: [137284]
    Other proteins in same PDB: d2idob_, d2idod_
    automated match to d1j53a_
    complexed with edo, mn, tmp

Details for d2idoa_

PDB Entry: 2ido (more details), 2.1 Å

PDB Description: Structure of the E. coli Pol III epsilon-Hot proofreading complex
PDB Compounds: (A:) DNA polymerase III epsilon subunit

SCOPe Domain Sequences for d2idoa_:

Sequence, based on SEQRES records: (download)

>d2idoa_ c.55.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
trqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgv
hgiadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfc
kvtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg

Sequence, based on observed residues (ATOM records): (download)

>d2idoa_ c.55.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
trqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgv
hgiadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfc
kvtdslavarkmfpgkrnsldalcaryeidnsrlhgalldaqilaevylamtg

SCOPe Domain Coordinates for d2idoa_:

Click to download the PDB-style file with coordinates for d2idoa_.
(The format of our PDB-style files is described here.)

Timeline for d2idoa_: