SCOPe 2.08: Domain d2idoa_: 2ido A:

Lineage for d2idoa_ (2ido A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein automated matches [190162] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187263] (14 PDB entries)

8. Domain d2idoa_: 2ido A: [137284]
   Other proteins in same PDB: d2idob_, d2idod_
   automated match to d1j53a_
   complexed with edo, mn, tmp

Details for d2idoa_

PDB Entry: 2ido, 2.1 Å

PDB Description: Structure of the E. coli Pol III epsilon-Hot proofreading complex

PDB Compounds: (A:) DNA polymerase III epsilon subunit

SCOPe Domain Sequences for d2idoa_:

Sequence, based on SEQRES records:

>d2idoa_ c.55.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
trqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgv
hgiadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfc
kvtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg

Sequence, based on observed residues (ATOM records):

>d2idoa_ c.55.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
trqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgv
hgiadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfc
kvtdslavarkmfpgkrnsldalcaryeidnsrlhgalldaqilaevylamtg

Timeline for d2idoa_:

• d2idoa_ first appeared in SCOP 1.73, called d2idoa1
  
• d2idoa_ appears in SCOPe 2.07