Lineage for d2idbc2 (2idb C:326-491)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882676Fold d.333: UbiD C-terminal domain-like [143967] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha-beta(2); 3 layers, a/b/a; mixed beta-sheet, order: 12354, strands 2,3 and 5 are parallel to each other
  4. 882677Superfamily d.333.1: UbiD C-terminal domain-like [143968] (1 family) (S)
  5. 882678Family d.333.1.1: UbiD C-terminal domain-like [143969] (1 protein)
    C-terminal part of Pfam PF01977; hexamerisation domain
  6. 882679Protein 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [143970] (1 species)
  7. 882680Species Escherichia coli [TaxId:562] [143971] (1 PDB entry)
    Uniprot P0AAB4 326-491
  8. 882683Domain d2idbc2: 2idb C:326-491 [137275]
    Other proteins in same PDB: d2idba1, d2idbb1, d2idbc1
    automatically matched to 2IDB A:326-491
    complexed with 1pe, edo

Details for d2idbc2

PDB Entry: 2idb (more details), 2.9 Å

PDB Description: crystal structure of 3-octaprenyl-4-hydroxybenzoate decarboxylase (ubid) from escherichia coli, northeast structural genomics target er459.
PDB Compounds: (C:) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

SCOP Domain Sequences for d2idbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2idbc2 d.333.1.1 (C:326-491) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD {Escherichia coli [TaxId: 562]}
pdepavlgvalnevfvpilqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgv
wsflrqfmytkfvivcdddvnardwndviwaittrmdpardtvlventpidyldfaspvs
glgskmgldatnkwpgetqrewgrpikkdpdvvahidaiwdelaif

SCOP Domain Coordinates for d2idbc2:

Click to download the PDB-style file with coordinates for d2idbc2.
(The format of our PDB-style files is described here.)

Timeline for d2idbc2: