![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.333: UbiD C-terminal domain-like [143967] (1 superfamily) alpha-beta(2)-alpha-beta-alpha-beta(2); 3 layers, a/b/a; mixed beta-sheet, order: 12354, strands 2,3 and 5 are parallel to each other |
![]() | Superfamily d.333.1: UbiD C-terminal domain-like [143968] (2 families) ![]() |
![]() | Family d.333.1.1: UbiD C-terminal domain-like [143969] (1 protein) C-terminal part of Pfam PF01977; hexamerisation domain |
![]() | Protein 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [143970] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [143971] (1 PDB entry) Uniprot P0AAB4 326-491 |
![]() | Domain d2idbc2: 2idb C:326-491 [137275] Other proteins in same PDB: d2idba1, d2idbb1, d2idbc1 automated match to d2idba2 complexed with 1pe, edo |
PDB Entry: 2idb (more details), 2.9 Å
SCOPe Domain Sequences for d2idbc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2idbc2 d.333.1.1 (C:326-491) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD {Escherichia coli [TaxId: 562]} pdepavlgvalnevfvpilqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgv wsflrqfmytkfvivcdddvnardwndviwaittrmdpardtvlventpidyldfaspvs glgskmgldatnkwpgetqrewgrpikkdpdvvahidaiwdelaif
Timeline for d2idbc2:
![]() Domains from other chains: (mouse over for more information) d2idba1, d2idba2, d2idbb1, d2idbb2 |