![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.45: Split barrel-like [50474] (2 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (3 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.3: UbiD middle domain-like [141368] (1 protein) N terminal part of Pfam PF01977; overall structural similarity to one subunit of the NADH:FMN oxidoreductase-like family (scop_fa 50482); not known to bind a flavin cofactor; also includes the N-terminal alpha+beta subdomain (~110 residues) |
![]() | Protein 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [141369] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [141370] (1 PDB entry) |
![]() | Domain d2idbc1: 2idb C:6-325 [137274] Other proteins in same PDB: d2idba2, d2idbb2, d2idbc2 automatically matched to 2IDB A:6-325 complexed with 1pe, edo |
PDB Entry: 2idb (more details), 2.9 Å
SCOP Domain Sequences for d2idbc1:
Sequence, based on SEQRES records: (download)
>d2idbc1 b.45.1.3 (C:6-325) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD {Escherichia coli [TaxId: 562]} yndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcn lfgtpkrvamgmgqedvsalrevgkllaflkepeppkgfrdlfdklpqfkqvlnmptkrl rgapcqqkivsgddvdlnripimtcwpedaaplitwgltvtrgphkerqnlgiyrqqlig knklimrwlshrggaldyqewcaahpgerfpvsvalgadpatilgavtpvpdtlseyafa gllrgtktevvkcisndlevpasaeivlegyieqgetapegpygdhtgyynevdsfpvft vthitqredaiyhstytgrp
>d2idbc1 b.45.1.3 (C:6-325) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD {Escherichia coli [TaxId: 562]} yndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcn lfgtpkrvamgmgqedvsalrevgkllaflkkrlrgapcqqkivsgddvdlnripimtcw pedaaplitwgltvtrgphkerqnlgiyrqqligknklimrwlshrggaldyqewcaahp gerfpvsvalgadpatilgavtpseyafagllrgtktevvkcisndlevpasaeivlegy ieqgetapegpygdhtgyynevdsfpvftvthitqredaiyhstytgrp
Timeline for d2idbc1:
![]() Domains from other chains: (mouse over for more information) d2idba1, d2idba2, d2idbb1, d2idbb2 |