Lineage for d2idbc1 (2idb C:5-325)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055233Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2055414Family b.45.1.3: UbiD middle domain-like [141368] (2 protein domains)
    N terminal part of Pfam PF01977; overall structural similarity to one subunit of the NADH:FMN oxidoreductase-like family (50482); not known to bind a flavin cofactor; also includes the N-terminal alpha+beta subdomain (~110 residues)
  6. 2055415Protein 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [141369] (1 species)
  7. 2055416Species Escherichia coli [TaxId:562] [141370] (1 PDB entry)
    Uniprot P0AAB4 6-325
  8. 2055419Domain d2idbc1: 2idb C:5-325 [137274]
    Other proteins in same PDB: d2idba2, d2idbb2, d2idbc2
    automated match to d2idba1
    complexed with 1pe, edo

Details for d2idbc1

PDB Entry: 2idb (more details), 2.9 Å

PDB Description: crystal structure of 3-octaprenyl-4-hydroxybenzoate decarboxylase (ubid) from escherichia coli, northeast structural genomics target er459.
PDB Compounds: (C:) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

SCOPe Domain Sequences for d2idbc1:

Sequence, based on SEQRES records: (download)

>d2idbc1 b.45.1.3 (C:5-325) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD {Escherichia coli [TaxId: 562]}
kyndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlc
nlfgtpkrvamgmgqedvsalrevgkllaflkepeppkgfrdlfdklpqfkqvlnmptkr
lrgapcqqkivsgddvdlnripimtcwpedaaplitwgltvtrgphkerqnlgiyrqqli
gknklimrwlshrggaldyqewcaahpgerfpvsvalgadpatilgavtpvpdtlseyaf
agllrgtktevvkcisndlevpasaeivlegyieqgetapegpygdhtgyynevdsfpvf
tvthitqredaiyhstytgrp

Sequence, based on observed residues (ATOM records): (download)

>d2idbc1 b.45.1.3 (C:5-325) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD {Escherichia coli [TaxId: 562]}
kyndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlc
nlfgtpkrvamgmgqedvsalrevgkllaflkkrlrgapcqqkivsgddvdlnripimtc
wpedaaplitwgltvtrgphkerqnlgiyrqqligknklimrwlshrggaldyqewcaah
pgerfpvsvalgadpatilgavtpseyafagllrgtktevvkcisndlevpasaeivleg
yieqgetapegpygdhtgyynevdsfpvftvthitqredaiyhstytgrp

SCOPe Domain Coordinates for d2idbc1:

Click to download the PDB-style file with coordinates for d2idbc1.
(The format of our PDB-style files is described here.)

Timeline for d2idbc1: