Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.333: UbiD C-terminal domain-like [143967] (1 superfamily) alpha-beta(2)-alpha-beta-alpha-beta(2); 3 layers, a/b/a; mixed beta-sheet, order: 12354, strands 2,3 and 5 are parallel to each other |
Superfamily d.333.1: UbiD C-terminal domain-like [143968] (1 family) |
Family d.333.1.1: UbiD C-terminal domain-like [143969] (1 protein) C-terminal part of Pfam PF01977; hexamerisation domain |
Protein 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [143970] (1 species) |
Species Escherichia coli [TaxId:562] [143971] (1 PDB entry) |
Domain d2idbb2: 2idb B:326-491 [137273] Other proteins in same PDB: d2idba1, d2idbb1, d2idbc1 automatically matched to 2IDB A:326-491 complexed with 1pe, edo |
PDB Entry: 2idb (more details), 2.9 Å
SCOP Domain Sequences for d2idbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2idbb2 d.333.1.1 (B:326-491) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD {Escherichia coli [TaxId: 562]} pdepavlgvalnevfvpilqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgv wsflrqfmytkfvivcdddvnardwndviwaittrmdpardtvlventpidyldfaspvs glgskmgldatnkwpgetqrewgrpikkdpdvvahidaiwdelaif
Timeline for d2idbb2:
View in 3D Domains from other chains: (mouse over for more information) d2idba1, d2idba2, d2idbc1, d2idbc2 |