Class b: All beta proteins [48724] (180 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.3: UbiD middle domain-like [141368] (2 proteins) N terminal part of Pfam PF01977; overall structural similarity to one subunit of the NADH:FMN oxidoreductase-like family (50482); not known to bind a flavin cofactor; also includes the N-terminal alpha+beta subdomain (~110 residues) |
Protein 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [141369] (1 species) |
Species Escherichia coli [TaxId:562] [141370] (1 PDB entry) Uniprot P0AAB4 6-325 |
Domain d2idbb1: 2idb B:7-325 [137272] Other proteins in same PDB: d2idba2, d2idbb2, d2idbc2 automated match to d2idba1 complexed with 1pe, edo |
PDB Entry: 2idb (more details), 2.9 Å
SCOPe Domain Sequences for d2idbb1:
Sequence, based on SEQRES records: (download)
>d2idbb1 b.45.1.3 (B:7-325) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD {Escherichia coli [TaxId: 562]} ndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcnl fgtpkrvamgmgqedvsalrevgkllaflkepeppkgfrdlfdklpqfkqvlnmptkrlr gapcqqkivsgddvdlnripimtcwpedaaplitwgltvtrgphkerqnlgiyrqqligk nklimrwlshrggaldyqewcaahpgerfpvsvalgadpatilgavtpvpdtlseyafag llrgtktevvkcisndlevpasaeivlegyieqgetapegpygdhtgyynevdsfpvftv thitqredaiyhstytgrp
>d2idbb1 b.45.1.3 (B:7-325) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD {Escherichia coli [TaxId: 562]} ndlrdfltlleqqgelkritlpvdphleiteiadrtlraggpallfenpkgysmpvlcnl fgtpkrvamgmgqedvsalrevgkllamptkrlrgapcqqkivsgddvdlnripimtcwp edaaplitwgltvtrgphkerqnlgiyrqqligknklimrwlshrggaldyqewcaahpg erfpvsvalgadpatilgavtpveyafagllrgtktevvkcisndlevpasaeivlegyi eqgetapegpygdhtgyynevdsfpvftvthitqredaiyhstytgrp
Timeline for d2idbb1:
View in 3D Domains from other chains: (mouse over for more information) d2idba1, d2idba2, d2idbc1, d2idbc2 |