SCOPe 2.07: Domain d2idba2: 2idb A:326-491

Lineage for d2idba2 (2idb A:326-491)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.333: UbiD C-terminal domain-like [143967] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha-beta(2); 3 layers, a/b/a; mixed beta-sheet, order: 12354, strands 2,3 and 5 are parallel to each other

4. Superfamily d.333.1: UbiD C-terminal domain-like [143968] (2 families)

5. Family d.333.1.1: UbiD C-terminal domain-like [143969] (1 protein)
   C-terminal part of Pfam PF01977; hexamerisation domain

6. Protein 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [143970] (1 species)

7. Species Escherichia coli [TaxId:562] [143971] (1 PDB entry)
   Uniprot P0AAB4 326-491

8. Domain d2idba2: 2idb A:326-491 [137271]
   Other proteins in same PDB: d2idba1, d2idbb1, d2idbc1
   complexed with 1pe, edo

Details for d2idba2

PDB Entry: 2idb, 2.9 Å

PDB Description: crystal structure of 3-octaprenyl-4-hydroxybenzoate decarboxylase (ubid) from escherichia coli, northeast structural genomics target er459.

PDB Compounds: (A:) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

SCOPe Domain Sequences for d2idba2:

Sequence; same for both SEQRES and ATOM records:

>d2idba2 d.333.1.1 (A:326-491) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD {Escherichia coli [TaxId: 562]}
pdepavlgvalnevfvpilqkqfpeivdfylppegcsyrlavvtikkqyaghakrvmmgv
wsflrqfmytkfvivcdddvnardwndviwaittrmdpardtvlventpidyldfaspvs
glgskmgldatnkwpgetqrewgrpikkdpdvvahidaiwdelaif

Timeline for d2idba2:

• d2idba2 first appeared in SCOP 1.73
  
• d2idba2 appears in SCOPe 2.06
  
• d2idba2 appears in the current release, SCOPe 2.08