Lineage for d2id4b2 (2id4 B:122-460)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873307Family c.41.1.1: Subtilases [52744] (15 proteins)
  6. 2873330Protein Kexin, N-terminal domain [89692] (1 species)
  7. 2873331Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89693] (3 PDB entries)
  8. 2873333Domain d2id4b2: 2id4 B:122-460 [137268]
    Other proteins in same PDB: d2id4a1, d2id4b1
    automatically matched to d1r64a2
    complexed with ca, mla, na, nag

Details for d2id4b2

PDB Entry: 2id4 (more details), 1.9 Å

PDB Description: the 1.9 a structure of kex2 in complex with an ac-r-e-r-k-chloromethyl ketone inhibitor.
PDB Compounds: (B:) Kexin

SCOPe Domain Sequences for d2id4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2id4b2 c.41.1.1 (B:122-460) Kexin, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lpvkeaedklsindplferqwhlvnpsfpgsdinvldlwynnitgagvvaaivddgldye
nedlkdnfcaegswdfndntnlpkprlsddyhgtrcageiaakkgnnfcgvgvgynakis
girilsgdittedeaasliygldvndiyscswgpaddgrhlqgpsdlvkkalvkgvtegr
dskgaiyvfasgnggtrgdncnydgytnsiysitigaidhkdlhppysegcsavmavtys
sgsgeyihssdingrcsnshggtsaaaplaagvytllleanpnltwrdvqylsilsavgl
eknadgdwrdsamgkkyshrygfgkidahkliemsktwe

SCOPe Domain Coordinates for d2id4b2:

Click to download the PDB-style file with coordinates for d2id4b2.
(The format of our PDB-style files is described here.)

Timeline for d2id4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2id4b1