SCOP 1.75: Domain d2id4a1: 2id4 A:461-601

Lineage for d2id4a1 (2id4 A:461-601)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families)

5. Family b.18.1.20: Proprotein convertase P-domain [89249] (3 proteins)
   a truncated form of this fold lacking one of the N-terminal strands

6. Protein Kexin, C-terminal domain [89250] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89251] (3 PDB entries)

8. Domain d2id4a1: 2id4 A:461-601 [137265]
   Other proteins in same PDB: d2id4a2, d2id4b2
   automatically matched to d1r64a1
   complexed with ace, ca, mla, na, nag; mutant

Details for d2id4a1

PDB Entry: 2id4, 1.9 Å

PDB Description: the 1.9 a structure of kex2 in complex with an ac-r-e-r-k-chloromethyl ketone inhibitor.

PDB Compounds: (A:) Kexin

SCOP Domain Sequences for d2id4a1:

Sequence; same for both SEQRES and ATOM records:

>d2id4a1 b.18.1.20 (A:461-601) Kexin, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nvnaqtwfylptlyvsqstnsteetlesvitisekslqdanfkriehvtvtvdidteirg
tttvdlispagiisnlgvvrprdvssegfkdwtfmsvahwgengvgdwkikvkttenghr
idfhswrlklfgesidsskte

Timeline for d2id4a1:

• d2id4a1 first appeared in SCOP 1.73
  
• d2id4a1 appears in SCOPe 2.01
  
• d2id4a1 appears in the current release, SCOPe 2.08