SCOPe 2.04: Domain d2id3b2: 2id3 B:81-203

Lineage for d2id3b2 (2id3 B:81-203)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Putative transcriptional regulator SCO5951 [140875] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [140876] (1 PDB entry)
   Uniprot O54180 81-203

8. Domain d2id3b2: 2id3 B:81-203 [137264]
   Other proteins in same PDB: d2id3a1, d2id3b1
   automated match to d2id3a2
   complexed with ca, cl

Details for d2id3b2

PDB Entry: 2id3, 1.7 Å

PDB Description: crystal structure of transcriptional regulator sco5951 from streptomyces coelicolor a3(2)

PDB Compounds: (B:) Putative transcriptional regulator

SCOPe Domain Sequences for d2id3b2:

Sequence; same for both SEQRES and ATOM records:

>d2id3b2 a.121.1.1 (B:81-203) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]}
adtgaleedlranarlvvrtlddprqgrlfraliaaslcneqaaealhrfyavrvdewag
cvrdavargevpdgtdphgvvaavsaplyyallntgrslteadadraaraastaaragvw
vtg

Timeline for d2id3b2:

• d2id3b2 first appeared in SCOP 1.73
  
• d2id3b2 appears in SCOPe 2.03
  
• d2id3b2 appears in SCOPe 2.05
  
• d2id3b2 appears in the current release, SCOPe 2.08