![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
![]() | Protein Putative transcriptional regulator SCO5951 [140875] (1 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [140876] (1 PDB entry) Uniprot O54180 81-203 |
![]() | Domain d2id3b2: 2id3 B:81-203 [137264] Other proteins in same PDB: d2id3a1, d2id3b1 automated match to d2id3a2 complexed with ca, cl |
PDB Entry: 2id3 (more details), 1.7 Å
SCOPe Domain Sequences for d2id3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2id3b2 a.121.1.1 (B:81-203) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]} adtgaleedlranarlvvrtlddprqgrlfraliaaslcneqaaealhrfyavrvdewag cvrdavargevpdgtdphgvvaavsaplyyallntgrslteadadraaraastaaragvw vtg
Timeline for d2id3b2: