![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Putative transcriptional regulator SCO5951 [140179] (1 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [140180] (1 PDB entry) Uniprot O54180 13-80 |
![]() | Domain d2id3b1: 2id3 B:14-80 [137263] Other proteins in same PDB: d2id3a2, d2id3b2 automated match to d2id3a1 complexed with ca, cl |
PDB Entry: 2id3 (more details), 1.7 Å
SCOPe Domain Sequences for d2id3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2id3b1 a.4.1.9 (B:14-80) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]} grtarireavllaagdalaadgfdaldlgeiarragvgkttvyrrwgtpgglaadlladm aeqslpr
Timeline for d2id3b1: