Lineage for d2id3b1 (2id3 B:14-80)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761140Superfamily a.4.1: Homeodomain-like [46689] (19 families) (S)
    consists only of helices
  5. 761504Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)
  6. 761660Protein Putative transcriptional regulator SCO5951 [140179] (1 species)
  7. 761661Species Streptomyces coelicolor [TaxId:1902] [140180] (1 PDB entry)
    Uniprot O54180 13-80
  8. 761663Domain d2id3b1: 2id3 B:14-80 [137263]
    Other proteins in same PDB: d2id3a2, d2id3b2
    automatically matched to 2ID3 A:13-80
    complexed with ca, cl

Details for d2id3b1

PDB Entry: 2id3 (more details), 1.7 Å

PDB Description: crystal structure of transcriptional regulator sco5951 from streptomyces coelicolor a3(2)
PDB Compounds: (B:) Putative transcriptional regulator

SCOP Domain Sequences for d2id3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2id3b1 a.4.1.9 (B:14-80) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]}
grtarireavllaagdalaadgfdaldlgeiarragvgkttvyrrwgtpgglaadlladm
aeqslpr

SCOP Domain Coordinates for d2id3b1:

Click to download the PDB-style file with coordinates for d2id3b1.
(The format of our PDB-style files is described here.)

Timeline for d2id3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2id3b2