SCOPe 2.08: Domain d2id3b1: 2id3 B:14-80

Lineage for d2id3b1 (2id3 B:14-80)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Putative transcriptional regulator SCO5951 [140179] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [140180] (1 PDB entry)
   Uniprot O54180 13-80

8. Domain d2id3b1: 2id3 B:14-80 [137263]
   Other proteins in same PDB: d2id3a2, d2id3b2
   automated match to d2id3a1
   complexed with ca, cl

Details for d2id3b1

PDB Entry: 2id3, 1.7 Å

PDB Description: crystal structure of transcriptional regulator sco5951 from streptomyces coelicolor a3(2)

PDB Compounds: (B:) Putative transcriptional regulator

SCOPe Domain Sequences for d2id3b1:

Sequence; same for both SEQRES and ATOM records:

>d2id3b1 a.4.1.9 (B:14-80) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]}
grtarireavllaagdalaadgfdaldlgeiarragvgkttvyrrwgtpgglaadlladm
aeqslpr

Timeline for d2id3b1:

• d2id3b1 first appeared in SCOP 1.73
  
• d2id3b1 appears in SCOPe 2.07