Lineage for d2id3a2 (2id3 A:81-203)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647677Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 647678Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 647679Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (28 protein domains)
  6. 647786Protein Putative transcriptional regulator SCO5951 [140875] (1 species)
  7. 647787Species Streptomyces coelicolor [TaxId:1902] [140876] (1 PDB entry)
  8. 647788Domain d2id3a2: 2id3 A:81-203 [137262]
    Other proteins in same PDB: d2id3a1, d2id3b1
    complexed with ca, cl

Details for d2id3a2

PDB Entry: 2id3 (more details), 1.7 Å

PDB Description: crystal structure of transcriptional regulator sco5951 from streptomyces coelicolor a3(2)
PDB Compounds: (A:) Putative transcriptional regulator

SCOP Domain Sequences for d2id3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2id3a2 a.121.1.1 (A:81-203) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]}
adtgaleedlranarlvvrtlddprqgrlfraliaaslcneqaaealhrfyavrvdewag
cvrdavargevpdgtdphgvvaavsaplyyallntgrslteadadraaraastaaragvw
vtg

SCOP Domain Coordinates for d2id3a2:

Click to download the PDB-style file with coordinates for d2id3a2.
(The format of our PDB-style files is described here.)

Timeline for d2id3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2id3a1