Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
Protein Putative transcriptional regulator SCO5951 [140179] (1 species) |
Species Streptomyces coelicolor [TaxId:1902] [140180] (1 PDB entry) Uniprot O54180 13-80 |
Domain d2id3a1: 2id3 A:13-80 [137261] Other proteins in same PDB: d2id3a2, d2id3b2 complexed with ca, cl |
PDB Entry: 2id3 (more details), 1.7 Å
SCOPe Domain Sequences for d2id3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2id3a1 a.4.1.9 (A:13-80) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]} ggrtarireavllaagdalaadgfdaldlgeiarragvgkttvyrrwgtpgglaadllad maeqslpr
Timeline for d2id3a1: