Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 proteins) |
Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [142686] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142687] (4 PDB entries) Uniprot Q9M9P3 6-383 |
Domain d2icyb2: 2icy B:7-383 [137260] Other proteins in same PDB: d2icya1, d2icyb1 automated match to d2icyb2 complexed with dms, upg |
PDB Entry: 2icy (more details), 1.64 Å
SCOPe Domain Sequences for d2icyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2icyb2 c.68.1.5 (B:7-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} nlpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpyekmtpv sqdvaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkyg ckvplvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkeg wyppghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycme vtpktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikk lveadalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdll lvqsdlytlvdgfvtrn
Timeline for d2icyb2: