![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 proteins) |
![]() | Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [142686] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142687] (4 PDB entries) Uniprot Q9M9P3 6-383 |
![]() | Domain d2icxb2: 2icx B:8-383 [137256] Other proteins in same PDB: d2icxa1, d2icxb1 automated match to d2icyb2 complexed with dms, utp has additional subdomain(s) that are not in the common domain |
PDB Entry: 2icx (more details), 1.85 Å
SCOPe Domain Sequences for d2icxb2:
Sequence, based on SEQRES records: (download)
>d2icxb2 c.68.1.5 (B:8-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpyekmtpvs qdvaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkygc kvplvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkegw yppghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycmev tpktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikkl veadalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdlll vqsdlytlvdgfvtrn
>d2icxb2 c.68.1.5 (B:8-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} lpqlksavdgltemseseksgfislvsrylsgqhiewskiqtptdeivvpyekmtpvsqd vaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkygckv plvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkegwyp pghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycmevtp ktadvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikklvea dalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdlllvqs dlytlvdgfvtrn
Timeline for d2icxb2: