Lineage for d2icxb2 (2icx B:8-383)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133197Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 protein domains)
  6. 2133223Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [142686] (1 species)
  7. 2133224Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142687] (4 PDB entries)
    Uniprot Q9M9P3 6-383
  8. 2133228Domain d2icxb2: 2icx B:8-383 [137256]
    Other proteins in same PDB: d2icxa1, d2icxb1
    automated match to d2icyb2
    complexed with dms, utp

Details for d2icxb2

PDB Entry: 2icx (more details), 1.85 Å

PDB Description: Crystal Structure of a Putative UDP-glucose Pyrophosphorylase from Arabidopsis Thaliana with Bound UTP
PDB Compounds: (B:) Probable UTP-glucose-1-phosphate uridylyltransferase 2

SCOPe Domain Sequences for d2icxb2:

Sequence, based on SEQRES records: (download)

>d2icxb2 c.68.1.5 (B:8-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpyekmtpvs
qdvaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkygc
kvplvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkegw
yppghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycmev
tpktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikkl
veadalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdlll
vqsdlytlvdgfvtrn

Sequence, based on observed residues (ATOM records): (download)

>d2icxb2 c.68.1.5 (B:8-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lpqlksavdgltemseseksgfislvsrylsgqhiewskiqtptdeivvpyekmtpvsqd
vaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkygckv
plvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkegwyp
pghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycmevtp
ktadvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikklvea
dalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdlllvqs
dlytlvdgfvtrn

SCOPe Domain Coordinates for d2icxb2:

Click to download the PDB-style file with coordinates for d2icxb2.
(The format of our PDB-style files is described here.)

Timeline for d2icxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2icxb1