Lineage for d2icxa2 (2icx A:8-383)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841352Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 841353Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (19 families) (S)
  5. 841408Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (3 proteins)
  6. 841432Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [142686] (1 species)
  7. 841433Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142687] (4 PDB entries)
    Uniprot Q9M9P3 6-383
  8. 841436Domain d2icxa2: 2icx A:8-383 [137254]
    Other proteins in same PDB: d2icxa1, d2icxb1
    automatically matched to 1Z90 A:6-383
    complexed with dms, utp

Details for d2icxa2

PDB Entry: 2icx (more details), 1.85 Å

PDB Description: Crystal Structure of a Putative UDP-glucose Pyrophosphorylase from Arabidopsis Thaliana with Bound UTP
PDB Compounds: (A:) Probable UTP-glucose-1-phosphate uridylyltransferase 2

SCOP Domain Sequences for d2icxa2:

Sequence, based on SEQRES records: (download)

>d2icxa2 c.68.1.5 (A:8-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpyekmtpvs
qdvaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkygc
kvplvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkegw
yppghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycmev
tpktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikkl
veadalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdlll
vqsdlytlvdgfvtrn

Sequence, based on observed residues (ATOM records): (download)

>d2icxa2 c.68.1.5 (A:8-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lpqlksavdgltemseseksgfislvsrylsgewskiqtptdeivvpyekmtpvsqdvae
tknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkygckvplv
lmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkegwyppgh
gdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycmevtpktl
adggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikklveadalk
meiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdlllvqsdlyt
lvdgfvtrn

SCOP Domain Coordinates for d2icxa2:

Click to download the PDB-style file with coordinates for d2icxa2.
(The format of our PDB-style files is described here.)

Timeline for d2icxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2icxa1